DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and SPH93

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_609840.1 Gene:SPH93 / 35049 FlyBaseID:FBgn0032638 Length:494 Species:Drosophila melanogaster


Alignment Length:294 Identity:74/294 - (25%)
Similarity:120/294 - (40%) Gaps:53/294 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LLDSSCGTTKPEFIPMITGGA--DAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVS-- 83
            ||..|||.:....:.|:.|..  .|.....||.|.:.  |:.|.|||||....|||.||.:::  
  Fly   228 LLSPSCGMSNANGLQMVEGITIDQARPAQYPWAVAIFHNGQYLAGGSLIQPNVVLTVAHRVITIE 292

  Fly    84 THMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADY 148
            |.:.||.|::..:..              |.|.|.|                :..|:|.::|..:
  Fly   293 TELVVRAGDWDLKSD--------------REIFLSE----------------QREVERAVIHEGF 327

  Fly   149 NLNLD-NDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVT--NDGTPSRRLQRATV 210
            :.... |::.||.:.|..:.:|::|.|||.............:.|||..  .|...|..|::..:
  Fly   328 DFKSGANNLALLFLNSPFKLNDHIRTICLPTPNKSFAGRRCTVAGWGKMRYEDQRYSTVLKKVQL 392

  Fly   211 YNTDLHFCRSKFTK--------QVDESQICAAG-TNSDACHGDSGGPLSAQVPFAGSWLTFQYGL 266
            ...:.:.| .||.:        ::.::.|||.| ...|.|.||.|..|...:....|.:..|.|:
  Fly   393 LVVNRNVC-EKFLRSTRLGAKFELPKNIICAGGELGRDTCTGDGGSALFCSIGGENSGVYEQAGI 456

  Fly   267 VSYGSAACHSF---SVYTNVTHHRDWIVNAIEDF 297
            |::| ..|...   ::||.|:...:||...:..|
  Fly   457 VNWG-VGCGQEGIPAIYTEVSKFTNWITEKLLPF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 65/269 (24%)
Tryp_SPc 41..290 CDD:238113 65/269 (24%)
SPH93NP_609840.1 GRP <136..189 CDD:254089
Tryp_SPc 250..485 CDD:238113 66/266 (25%)
Tryp_SPc 252..482 CDD:214473 64/261 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.