DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG4793

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:300 Identity:79/300 - (26%)
Similarity:123/300 - (41%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GHLLDSSCGTTKPEFIPMITGGAD-AGLFSNPWMVKVLGEK----LCGGSLITSRFVLTAAHCIV 82
            ||:.....|.|       ||...| |.....||||.:|..:    |.||||||...|||::...:
  Fly    87 GHVNRIGVGFT-------ITNARDIAQKGELPWMVALLDSRSRLPLGGGSLITRDVVLTSSTKTL 144

  Fly    83 STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKIL-HA 146
            .                      ||:.|.:  :|.||:|.    :.....:::|....|||: |.
  Fly   145 E----------------------VPEKYLI--VRAGEWDF----ESITEERAHEDVAIRKIVRHT 181

  Fly   147 DYNLNLD---NDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFN-------ITGWG--VTNDG 199
              ||:::   |:..||.:...::...::..|||       ..|..|       ::|||  ...|.
  Fly   182 --NLSVENGANNAALLFLARPLKLDHHIGLICL-------PPPNRNFIHNRCIVSGWGKKTALDN 237

  Fly   200 TPSRRLQRATVYNTDLHFCRSK----FTKQ--VDESQICAAG-TNSDACHGDSGGPLSAQVPFAG 257
            :....|::..:...|...|::|    :.|.  :|.|.|||.| ...|.|.||.|.||:.  |...
  Fly   238 SYMNILKKIELPLVDRSVCQTKLQGPYGKDFILDNSLICAGGEPGKDTCKGDGGAPLAC--PLQS 300

  Fly   258 SWLTFQ-YGLVSYGSAACHSF-SVYTNVTHHRDWIVNAIE 295
            ....:: .|:|::|....... :.||:|:..|.||.|.|:
  Fly   301 DPNRYELLGIVNFGFGCGGPLPAAYTDVSQIRSWIDNCIQ 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/275 (26%)
Tryp_SPc 41..290 CDD:238113 71/275 (26%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 70/270 (26%)
Tryp_SPc 105..335 CDD:214473 68/268 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.