DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG18478

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:296 Identity:76/296 - (25%)
Similarity:118/296 - (39%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGTTKPEFIPM---IT-GGADAGLFSNPWMVKVLGEK--LCGGSLITSRFVLTAAHCIVSTHMRV 88
            ||...|:.:.:   :| |.|....|  ||.:.|:..:  :.||||||...||||||         
  Fly    31 CGYGNPDAVKVQFNVTEGQAKPAEF--PWTIAVIHNRSLVGGGSLITPDIVLTAAH--------- 84

  Fly    89 RLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD-----TRFPGKDCCVPKSYELAVDRKILHADY 148
                   |...||....|        :..||::     .::|.::..|.|        .::|..:
  Fly    85 -------RIFNKDVEDIV--------VSAGEWEYGSALEKYPFEEAFVLK--------MVIHKSF 126

  Fly   149 NLNLD-NDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGV-----TNDGTPSRRLQR 207
            |.... |::.||.:......:..:..|||..:.....|....:.|||.     |:.|...:::..
  Fly   127 NYQRGANNLALLFLDREFPLTYKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDL 191

  Fly   208 ATVYNTDLHFCRSKFTK-------QVDESQICAAG-TNSDACHGDSGGPLSAQVPFAGSWLTF-Q 263
            ..|   ..|.|:.:..|       .:....|||.| .::|||.||.||.|..  |.......| |
  Fly   192 PIV---PRHICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFC--PMTEDPKQFEQ 251

  Fly   264 YGLVSYGSAACHSFSV---YTNVTHHRDWIVNAIED 296
            .|:|::| ..|...:|   ||:|...:.|||..|::
  Fly   252 IGIVNWG-VGCKEKNVPATYTDVFEFKPWIVQQIKE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 69/274 (25%)
Tryp_SPc 41..290 CDD:238113 69/274 (25%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 70/272 (26%)
Tryp_SPc 50..280 CDD:214473 67/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.