DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG5390

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:299 Identity:83/299 - (27%)
Similarity:123/299 - (41%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EGAPGHLLDSSCGTTKPEFIPM-ITGG----ADAGLFSNPWMVKVLGEK------LCGGSLITSR 72
            |..|.|  ...||...|..:.. |||.    |:.|.|  |||:.:|.|:      .|||:||...
  Fly   126 EFKPDH--PEGCGYQNPNGVGFKITGAVNQEAEFGEF--PWMLAILREEGNLNLYECGGALIAPN 186

  Fly    73 FVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYEL 137
            .|||||||:   |             .|..|..|        :|.||:||:...:   :.:..:.
  Fly   187 VVLTAAHCV---H-------------NKQPSSIV--------VRAGEWDTQTQTE---IRRHEDR 224

  Fly   138 AVDRKILHADYNL-NLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVT---ND 198
            .|...|.|..:|. :|.||:.::.::|.....:.::.:||...|...:......||||..   .|
  Fly   225 YVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQENIQTVCLPNVGDKFDFDRCYATGWGKNKFGKD 289

  Fly   199 GTPSRRLQRATVYNTDLHFCRSKFTKQ-------VDESQICAAG-TNSDACHGDSGGPLSAQVPF 255
            |.....|::..:.......|.:...:.       :.:|.|||.| .:.|.|.||.|.||..  |.
  Fly   290 GEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVC--PI 352

  Fly   256 AGSWLTFQ-YGLVSYGSAACHSFS---VYTNVTHHRDWI 290
            ||....|: .|:|::| ..|...:   ||.:|...|.||
  Fly   353 AGQKNRFKSAGIVAWG-IGCGEVNIPGVYASVAKLRPWI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 75/274 (27%)
Tryp_SPc 41..290 CDD:238113 75/274 (27%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 74/270 (27%)
Tryp_SPc 153..390 CDD:214473 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.