DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG40160

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001015212.1 Gene:CG40160 / 3354965 FlyBaseID:FBgn0058160 Length:421 Species:Drosophila melanogaster


Alignment Length:303 Identity:87/303 - (28%)
Similarity:122/303 - (40%) Gaps:90/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CGTTKPEFIPMITGGAD----------AGLFSNPWMVKVLG----EKLCGGSLITSRFVLTAAHC 80
            ||...       |||.|          ||....||.|.:|.    ...|.||||..:.|||||||
  Fly   151 CGVRN-------TGGLDFTLSGVSQNEAGFGEFPWTVALLHSGNLSYFCAGSLIHKQVVLTAAHC 208

  Fly    81 IVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDT-----RFPGKDCCVPKSYELAVD 140
            :.|    :|.|.:                    .:|.||:||     |.|.:        |.:|.
  Fly   209 VES----LRTGSF--------------------TVRAGEWDTQTMKERLPYQ--------ERSVQ 241

  Fly   141 RKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAE--SPIFNITGWGVTND---- 198
            ..|||.||| .::..|..|:.:...|...|::..|||..:..:.:  :..|: ||||  .|    
  Fly   242 TVILHPDYNRRSIAYDFALVILSQPVTLDDHINVICLPQQDDIPQPGNTCFS-TGWG--KDAFGS 303

  Fly   199 -GTPSRRLQRATVYNTDLHFCRS---------KFTKQVDESQICAAGTNS-DACHGDSGGPLSAQ 252
             |..|..::|..:...:.:.|::         ||.  :|.|.|||.|... |.|.||.|.||:..
  Fly   304 LGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFA--LDRSFICAGGQRGIDTCQGDGGAPLACP 366

  Fly   253 VPFAGSWLTFQY---GLVSYGSAACHSF--SVYTNVTHHRDWI 290
               .||....:|   |:|::| ..|:..  :.|.||...|.||
  Fly   367 ---RGSTRESRYQQTGIVAWG-IGCNDEVPAAYANVALVRGWI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 83/290 (29%)
Tryp_SPc 41..290 CDD:238113 83/290 (29%)
CG40160NP_001015212.1 Tryp_SPc 166..408 CDD:238113 81/281 (29%)
Tryp_SPc 169..405 CDD:214473 79/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.