DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG3117

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_608722.2 Gene:CG3117 / 33484 FlyBaseID:FBgn0031471 Length:347 Species:Drosophila melanogaster


Alignment Length:314 Identity:80/314 - (25%)
Similarity:114/314 - (36%) Gaps:87/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IQLGEGAPGHLLDSSCGTTKPEFI---PMITGG-ADAGLFSNPWMVKVL--GEKLCGGSLITSRF 73
            |.:.:..|.|.:|:...|:.|..:   |.:.|. .....|  ||:..:.  |..|.||||||...
  Fly    64 IGMSKSPPQHSVDTLLRTSYPNALDGSPQVFGDQTKPNQF--PWVTALFAKGSYLGGGSLITPGL 126

  Fly    74 VLTAAHCIVS---THMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSY 135
            ||||||.:..   ..:.||.||:       |.|    .|.||.           |..|..|.|..
  Fly   127 VLTAAHILAGLSPNDIMVRAGEW-------DLS----SSEKLN-----------PPMDRQVIKIM 169

  Fly   136 ELAVDRKILHADYNLNLD-NDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGWGVTNDG 199
            |        |..:|.:.. ||:.||.:.|..:....::.|.|.:.....:..|..:.|||:.:  
  Fly   170 E--------HEAFNYSSGANDLALLFLDSPFELRANIQTIRLPIPDKTFDRRICTVAGWGMRS-- 224

  Fly   200 TPSRRLQRATV-YNTDLHFCRS-------KFTK-----QVDESQICAAGTNS-DACHGDSGGPLS 250
              |..:...|: ...||....|       :.||     |:..|.:||.|... |.|         
  Fly   225 --STDVDIQTIQQKVDLPVVESSKCQRQLRLTKMGSNYQLPASLMCAGGEEGRDVC--------- 278

  Fly   251 AQVPFAGSWLTF-----------QYGLVSYGSAACHSFSVYTNVTH---HRDWI 290
               ...|.:..|           |.|:||:| ..|...:|.|..||   ..:||
  Fly   279 ---SLFGGFALFCSLDDDPNRYEQAGIVSFG-VGCGQANVPTTFTHVSKFMEWI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 71/283 (25%)
Tryp_SPc 41..290 CDD:238113 71/283 (25%)
CG3117NP_608722.2 Tryp_SPc 95..329 CDD:238113 73/283 (26%)
Tryp_SPc 95..328 CDD:214473 71/281 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.