DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG9673

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:307 Identity:81/307 - (26%)
Similarity:123/307 - (40%) Gaps:76/307 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAAGLALLVCSIQL-GEGAP-GHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGEK--LC 64
            |..||.||:..:.| .|.:| |.:|                ||.|......||...|...|  :|
  Fly     6 ITLGLGLLIFGLILSAEASPQGRIL----------------GGEDVAQGEYPWSASVRYNKAHVC 54

  Fly    65 GGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC 129
            .|::|::..:||||||:.|..:                   .|.......:|||..: ::.|...
  Fly    55 SGAIISTNHILTAAHCVSSVGI-------------------TPVDASTLAVRLGTIN-QYAGGSI 99

  Fly   130 CVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLL---------VEGHMAE- 184
            ...||.       |:|..|. |..:||.:|.:...:.:||.::.|.|.         |:..:.. 
  Fly   100 VNVKSV-------IIHPSYG-NFLHDIAILELDETLVFSDRIQDIALPPTTDEETEDVDAELPNG 156

  Fly   185 SPIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVD---ESQICAAGTNSDA-CHGDS 245
            :|:: :.|||..:|||.|.:.|:|. |||   ..||....:..   ||.:|.:....:. |.||:
  Fly   157 TPVY-VAGWGELSDGTASYKQQKAN-YNT---LSRSLCEWEAGYGYESVVCLSRAEGEGICRGDA 216

  Fly   246 GGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWI 290
            |    |.|......|.   ||.|:....|.|.  .|.|.|:::..||
  Fly   217 G----AAVIDDDKVLR---GLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 69/266 (26%)
Tryp_SPc 41..290 CDD:238113 69/266 (26%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 70/283 (25%)
Tryp_SPc 29..259 CDD:238113 72/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.