DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG31205

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:297 Identity:71/297 - (23%)
Similarity:105/297 - (35%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TTKPEFIPMITGGADAGLFS---------------NPWMVKVLG-------EKLCGGSLITSRFV 74
            ||....|...:.|.:.|:|:               :||:|:::|       ..||.|.||.||.|
  Fly    14 TTLHPTIQAASVGQECGIFNEKQYNSDNIIAEPTEHPWVVRIVGVTKDGSNTLLCTGILIDSRRV 78

  Fly    75 LTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAV 139
            :|||||:                 .||.|..:             |...|...|    .|....|
  Fly    79 VTAAHCV-----------------SKDESESI-------------YGVVFGDSD----SSNINLV 109

  Fly   140 DRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICL-----LVEGHMAESP---IFNITGWGV 195
            ....:|.||: ...:||:.::.:...|.:||.|:||||     :|.|....:.   :..:.|...
  Fly   110 SAVTVHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAGLEGPSF 174

  Fly   196 TNDGTPSRRLQ---RATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAG 257
            ....:.::||.   :.|....|...|..| ..:..|..||.....|         |||.......
  Fly   175 DRRHSATQRLDKRIKMTYTKIDSKECHEK-QARFPEELICGHTERS---------PLSGSALTEA 229

  Fly   258 SWLTFQYGLVSYGSAACHSFSV----YTNVTHHRDWI 290
            |....|:.|:....|...|..:    |.|:..|.|||
  Fly   230 SGTPRQFHLLGIAVAGFFSSDLDHQGYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 66/286 (23%)
Tryp_SPc 41..290 CDD:238113 66/286 (23%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442144
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.