DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG14780

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:99/241 - (41%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127
            :|||:||..|.|||||||:.:..        :.||  :..|..|        :.||..: ||..:
  Fly    64 ICGGALIAPRKVLTAAHCLYNNQ--------RKRF--RRASEFV--------VVLGTLN-RFEHR 109

  Fly   128 DCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSD------YVRPICLLVEGHMA-ES 185
            :..:.....   ....:|.....::.:|:|:|.:::.:..|.      .|.||.|  .|.:. ..
  Fly   110 NGTIVSQVS---SMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTVAPIQL--AGQITPPG 169

  Fly   186 PIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICA----AGTNSDACHGDSG 246
            .:..:.|||.|...:.|..|..|.|.......||..:...:....:||    .||  |:|.||||
  Fly   170 KLCQVAGWGRTEQSSLSNILLTANVSTIRHQTCRMIYRSGLLPGMMCAGRLQGGT--DSCQGDSG 232

  Fly   247 GPLSAQVPFAG--SWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWI 290
            |||..:....|  ||        .||.|......||.:|.::|.||
  Fly   233 GPLVHEGRLVGVVSW--------GYGCAEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 64/239 (27%)
Tryp_SPc 41..290 CDD:238113 64/239 (27%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 64/239 (27%)
Tryp_SPc 33..271 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.