DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG11664

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:264 Identity:67/264 - (25%)
Similarity:110/264 - (41%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 WMVKVLGEK-LCGGSLITSRFVLTAAHCIVST----HMRVRLGEYK---TRFPGKDCSRCVPKSY 110
            :::::.|.: |..|||.::|:|||.|||....    .:.||.| |:   ..|.||.         
  Fly    36 YVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAG-YRWIAWEFRGKQ--------- 90

  Fly   111 KLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYS---DYV 171
                                        |...:.|..:: |.|.|||.:||:|:.:.:|   :|:
  Fly    91 ----------------------------VAGLLRHPKFSPLTLRNDIAVLRVKAAISHSHMINYI 127

  Fly   172 ----RPICLLVEGHMAESPIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQIC 232
                ||:..|   :|. :|...:.||.:.:...|   |:..:|.......||..| .|:....||
  Fly   128 GLCSRPLTPL---NMF-APPQELAGWNLMHIAQP---LKSMSVQVEPEKNCRQWF-PQISGGVIC 184

  Fly   233 AAGTNSDA-CHGDSGGPLSAQVPFAGSWLTF-QYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIE 295
            |:.|..:. |:||||.||.:.....|..:.| :.|...|.       :::|:|.:||.:|..|:.
  Fly   185 ASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYP-------ALFTDVHYHRAFIAQAVL 242

  Fly   296 DFSR 299
            ...|
  Fly   243 TLDR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 64/253 (25%)
Tryp_SPc 41..290 CDD:238113 64/253 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 65/253 (26%)
Tryp_SPc 38..237 CDD:214473 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.