DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Pik3ip1

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001382087.1 Gene:Pik3ip1 / 305472 RGDID:1311203 Length:267 Species:Rattus norvegicus


Alignment Length:120 Identity:22/120 - (18%)
Similarity:42/120 - (35%) Gaps:39/120 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GEYDTR-FPGKDCCVPKSYELAVDRKILHADYNLNLDN----DIGLLRMKSFVQYSDYVRPICLL 177
            |:.:|: ||..: .:|...|.|..:.::.....:.:::    |:|.|         .||..:.:.
  Rat   128 GDKETQVFPPAN-ALPARSEAAEVQPVIGISQRVRMNSKEKKDLGTL---------GYVLGVTMT 182

  Fly   178 VEGHMAESPIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQIC 232
            |        |....|.|:....|                :.|.|..|:..|.::|
  Rat   183 V--------IIIAIGVGIVLGYT----------------YKRGKDLKEQHEQKVC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 22/120 (18%)
Tryp_SPc 41..290 CDD:238113 22/120 (18%)
Pik3ip1NP_001382087.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336775
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.