DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and GZMK

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_002095.1 Gene:GZMK / 3003 HGNCID:4711 Length:264 Species:Homo sapiens


Alignment Length:270 Identity:67/270 - (24%)
Similarity:114/270 - (42%) Gaps:62/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITGGADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPG---- 99
            |.||.:....|.|:|..:.  |..:|||.||..::|||||||    ..|...|:..|...|    
Human    27 IIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHC----QYRFTKGQSPTVVLGAHSL 87

  Fly   100 --KDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMK 162
              .:.|:   ::.::::.               :|.| .:..|.:          .|||.|::::
Human    88 SKNEASK---QTLEIKKF---------------IPFS-RVTSDPQ----------SNDIMLVKLQ 123

  Fly   163 SFVQYSDYVRPICLLVEGHMAESPIFNITGWGVTNDGT--PSRRLQRATVYNTDLHFCRSKFTKQ 225
            :..:.:.:|:.:.:..:..:.......:||||.|:..:  ||..|:..||.......|.|:....
Human   124 TAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYN 188

  Fly   226 VD----ESQICA--AGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSFS---VYT 281
            .|    :..:||  |....|:|.|||||||..:..|        :.:|| |...|...:   :||
Human   189 GDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVF--------HAIVS-GGHECGVATKPGIYT 244

  Fly   282 NVT-HHRDWI 290
            .:| .::.||
Human   245 LLTKKYQTWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 65/268 (24%)
Tryp_SPc 41..290 CDD:238113 65/268 (24%)
GZMKNP_002095.1 Tryp_SPc 26..254 CDD:214473 65/268 (24%)
Tryp_SPc 27..257 CDD:238113 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143015
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.