DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG18636

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:291 Identity:92/291 - (31%)
Similarity:134/291 - (46%) Gaps:35/291 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVCSIQLGEGAPGHLLDSSCG-TTKPEFIPMITGGADAGLFSNPWMV---KVLGEKLCGGSLITS 71
            ::...||........||.:|| .|:......|..|..|...|:||||   ......:|||||||.
  Fly    14 IILMFQLLHSGCSQFLDPACGIRTQSRTAYRIINGHTAKYNSSPWMVFLHSTTDMFVCGGSLITD 78

  Fly    72 RFVLTAAHC-IVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSY 135
            :.||||||| |.:.|:..|||||: |...::|:              |.|         |..:. 
  Fly    79 KLVLTAAHCFIANQHLVARLGEYE-RTRSEECT--------------GYY---------CNFRE- 118

  Fly   136 ELAVDRKILHADYNLNLD-NDIGLLRMKSFVQYSDYVRPICLLVE----GHMAESPIFNITGWGV 195
            |..||....|..|:.|.. |||.:||:...|.|.|.:||||::.:    .::.:..:...||||.
  Fly   119 EHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICVVWDHRWRHYLDKIDLLTATGWGK 183

  Fly   196 TNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAGSWL 260
            |...:.|..||...:.......|.....:.:..:|.||...:|:.|:|||||||.|.:....:..
  Fly   184 TQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFCAGNWDSNLCNGDSGGPLGAVITHKNTQR 248

  Fly   261 TFQYGLVSYGSAACHSFSVYTNVTHHRDWIV 291
            ..|.|:.||.:..|...||:|:|..|.::|:
  Fly   249 FVQVGIASYTNRNCQKASVFTDVLSHAEFIL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 84/257 (33%)
Tryp_SPc 41..290 CDD:238113 84/257 (33%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 84/258 (33%)
Tryp_SPc 45..278 CDD:238113 84/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.