DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG33225

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001286682.1 Gene:CG33225 / 2768860 FlyBaseID:FBgn0053225 Length:307 Species:Drosophila melanogaster


Alignment Length:299 Identity:118/299 - (39%)
Similarity:154/299 - (51%) Gaps:43/299 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLVCSIQLGEGAPGHLLDSSCGTTK-PEFIPMITGGADAGLFSNPWMVKVLGEK--LCGGSLI 69
            ||.||...:||...   ||.:.||||: |..|..:.||.||..|:|||||.||||.  .|.||||
  Fly    26 LASLVLGARLGSST---LLTNDCGTTRHPSRIRRVVGGNDADRFANPWMVMVLGENNVFCSGSLI 87

  Fly    70 TSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKS 134
            |..||||:|.|::|...:|.||||.......||:       .:|::                   
  Fly    88 TRLFVLTSASCLLSLPKQVILGEYDRNCTSADCT-------SIRQV------------------- 126

  Fly   135 YELAVDRKILHADYNLNL--DNDIGLLRMKSFVQYSDYVRPICLLVEGHMAES-PIFNITGWGVT 196
              :.:|:||:|..:.|..  ..||.|||:...|..|||||||||.|:..:..| ..|..||||.|
  Fly   127 --IDIDQKIIHGQFGLETVKKYDIALLRLAKKVSISDYVRPICLSVDRQVGRSVQHFTATGWGTT 189

  Fly   197 NDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLS--AQVPFAGSW 259
            ....||..||..|:...:..:|:.:..:.:|.||:|..|...|.|.||:|||||  .::...|.|
  Fly   190 EWNEPSTILQTVTLSKINRKYCKGRLRQNIDASQLCVGGPRKDTCSGDAGGPLSLTLKIDGDGKW 254

  Fly   260 ----LTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294
                ..|..|:|||||::|....|||||.|:.||||..|
  Fly   255 NNKSRAFLIGIVSYGSSSCSGIGVYTNVEHYMDWIVRTI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 100/259 (39%)
Tryp_SPc 41..290 CDD:238113 100/259 (39%)
CG33225NP_001286682.1 Tryp_SPc 56..289 CDD:214473 100/260 (38%)
Tryp_SPc 57..292 CDD:238113 103/262 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472848
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.