DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG33226

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:305 Identity:106/305 - (34%)
Similarity:151/305 - (49%) Gaps:43/305 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVCSI-------QLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVL--GEKLCG 65
            ||||.|       .||:    .|||.:|..|.......|.||.:|.:..:||||::|  |...||
  Fly    13 LLVCFILALRSYESLGQ----DLLDPNCVQTPVGVREQILGGHNADIKLHPWMVQILQRGYHFCG 73

  Fly    66 GSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCC 130
            ||||:|.||||||||.....::||.|.|....|...||              .:|         |
  Fly    74 GSLISSLFVLTAAHCHSRYRLKVRFGRYSGITPRYLCS--------------SQY---------C 115

  Fly   131 VPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLL-------VEGHMAESPIF 188
            .|...|:.|.|..||:.|....:.||.|..:...|:|:...||||:|       :...:....:|
  Fly   116 SPFGPEIDVKRIFLHSSYRDYHNYDIALFLLAKPVRYNVQTRPICVLQTSNKDKLRQFLNYVAMF 180

  Fly   189 NITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQV 253
            |:||||.|.....|..||..::::.|..||...|.:::....|||..:.|..|.|||||||||::
  Fly   181 NVTGWGKTESQLTSTILQTTSLFHLDRKFCAQIFDRKIGWPHICAGHSQSSTCTGDSGGPLSAEL 245

  Fly   254 PFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDFS 298
            .|:|...|..:|::|||:..|...:|:|||..:.:||.:.:.:|:
  Fly   246 TFSGVKRTVLFGIISYGAPNCREVTVFTNVLRYSNWIRDIVHNFT 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 91/257 (35%)
Tryp_SPc 41..290 CDD:238113 91/257 (35%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 93/260 (36%)
Tryp_SPc 47..282 CDD:214473 91/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472839
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.