DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG33459

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster


Alignment Length:308 Identity:115/308 - (37%)
Similarity:148/308 - (48%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSI---QLGEGAPGHLLDSSCGTTKPEFIPM---ITGGADAGLFSNPWMVKVL 59
            ||:|:   .|||.||   ||..|. ..||:.:||.     ||.   |.||.||||.|.|||..:.
  Fly     1 MKYIS---YLLVSSIIANQLLYGL-AVLLEPNCGQ-----IPFRMRIFGGMDAGLVSTPWMAFLH 56

  Fly    60 G--EKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD- 121
            .  :.|||||||||.||||||||::.|                      ||:.   .:|||||| 
  Fly    57 NHLQFLCGGSLITSEFVLTAAHCVMPT----------------------PKNL---TVRLGEYDW 96

  Fly   122 TRFPGKDCCVPK--SYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAE 184
            ||  ..|...||  ..|..|.|...|..|......||.||::...|:|:..:|||||::..:..|
  Fly    97 TR--QMDSINPKHRHREYMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHE 159

  Fly   185 -------SPIFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACH 242
                   ...|.:||||.|.....|:.||.|.:...|...|..::...||.:.|||..:.|.||.
  Fly   160 WYWLVDSVEDFTLTGWGATKTEPVSQVLQSANLTQIDRGTCHDRYGHSVDHTHICAGSSKSFACV 224

  Fly   243 GDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWI 290
            ||||.||:.:|.....::..|.|:||.|...|...:|:|||....:||
  Fly   225 GDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGVTVFTNVVSFTEWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 96/260 (37%)
Tryp_SPc 41..290 CDD:238113 96/260 (37%)
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 96/261 (37%)
Tryp_SPc 38..272 CDD:238113 96/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.