DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG33461

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:310 Identity:94/310 - (30%)
Similarity:132/310 - (42%) Gaps:39/310 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGEK--L 63
            ||.|.|.|||.|..:   .|:....|:.:||.. |.....|..|..|.|...|||..:....  |
  Fly     6 MKTIIAYLALFVLGV---HGSSSVFLEENCGVV-PRLSYKIINGTPARLGRYPWMAFLHTPTYFL 66

  Fly    64 CGGSLITSRFVLTAAHCIV-STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127
            |.||||...||||:||||. ...:..|||| ..|....||.                       .
  Fly    67 CAGSLINQWFVLTSAHCIEDDVELIARLGE-NNRDNDIDCE-----------------------N 107

  Fly   128 DCCVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMA----ESPI 187
            :.|:..:.|..||....|..|: .:..||||:||::..|:|:.:::|||:.....|.    :...
  Fly   108 NRCLEATQEYNVDMLFKHRLYDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITW 172

  Fly   188 FNITGWGVTN---DGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPL 249
            |..||||:|:   :...||.|....:|....:.|...|.:.....||||...:.:.|.||||||.
  Fly   173 FKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQICAGNDDGNLCRGDSGGPQ 237

  Fly   250 SAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIEDFSR 299
            ...|...|.....|.|:.|:....|...|:.|:|..:..||...::.:.|
  Fly   238 GRYVLIFGMKRFVQMGIASFTYENCSKVSILTDVVRYGRWIKKVVDWYGR 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 78/259 (30%)
Tryp_SPc 41..290 CDD:238113 78/259 (30%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 78/260 (30%)
Tryp_SPc 42..281 CDD:238113 80/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.