DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Prss45

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:113/271 - (41%) Gaps:71/271 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PW--MVKVLGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRI 115
            ||  .:::..:.:|||:||...:|::|||||...                       |.|.   :
Mouse    62 PWEASLQIEDKHVCGGALIDRSWVVSAAHCIQGN-----------------------KEYS---V 100

  Fly   116 RLGEYDTRFPGKDCCVPKSYELAVDRKILHADY---NLNLDNDIGLLRMKSFVQYSDYVRPICLL 177
            .||. .|..|.......|   :.|...|:|..|   |. :.:||.||.:::.|.::.||:||||.
Mouse   101 MLGS-STLHPNGSSWTLK---IPVGDIIIHPKYWGRNF-IRSDIALLCLETPVTFNKYVQPICLP 160

  Fly   178 VEGHMAESPIFN--------ITGWGVTNDG-----TPSRRLQRATVYNTDLHFCRSKFTKQ---- 225
            ...       ||        :||||.....     ||:..|..|.|:..|...|.|.|.|:    
Mouse   161 EHN-------FNFKVGTKCWVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIFHKKTLYP 218

  Fly   226 -----VDESQICAAGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSY--GSAACHSFSVYTNV 283
                 :.::.||......|.|:||.||||:.::.  |.|:.  .|:.|:  ..|...:.||||.:
Mouse   219 QVVPLIRKNMICTTNYGEDLCYGDPGGPLACEID--GRWIL--AGVFSWEKACATVPNLSVYTRI 279

  Fly   284 THHRDWIVNAI 294
            |.:..||.:.:
Mouse   280 TKYTIWIKDQV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/265 (27%)
Tryp_SPc 41..290 CDD:238113 72/265 (27%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 74/268 (28%)
Tryp_SPc 59..286 CDD:214473 72/265 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833185
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.