DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30289

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:301 Identity:140/301 - (46%)
Similarity:176/301 - (58%) Gaps:27/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPE-FIPMITGGADAGLFSNPWMVKVLGEKLC 64
            |:.|.|.:|.|||...........||..:||.:|.: ::|.|.|||...:..|||||.|...|.|
  Fly     1 MEVINAVIAALVCLFIANNNVMSRLLVENCGISKDDPYVPNIFGGAKTNIQENPWMVLVWSSKPC 65

  Fly    65 GGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDC 129
            |||||..:||||||||:....:.||||:|:|..|...|              |..:         
  Fly    66 GGSLIARQFVLTAAHCVSFEDLYVRLGDYETLDPMPYC--------------LNNH--------- 107

  Fly   130 CVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPIFNITGW 193
            |:||.|.::||.||:|.:|| :.|.|||.||||...|:||||||||||||...|...|:|.:|||
  Fly   108 CIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAVEYSDYVRPICLLVGEQMQSIPMFTVTGW 172

  Fly   194 GVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAGS 258
            |.|..|..||.|..||:||.|:.:|..||.||.|.|||||....|:.|.||||||||::..:...
  Fly   173 GETEYGQFSRILLNATLYNMDISYCNIKFNKQADRSQICAGSHTSNTCKGDSGGPLSSKFHYGNR 237

  Fly   259 WLTFQYGLVSYGSAAC--HSFSVYTNVTHHRDWIVNAIEDF 297
            .|:||||||||||..|  :...|||||::||:||.|.:..|
  Fly   238 LLSFQYGLVSYGSERCAANVAGVYTNVSYHREWIFNKMVQF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 123/251 (49%)
Tryp_SPc 41..290 CDD:238113 123/251 (49%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 123/251 (49%)
Tryp_SPc 42..271 CDD:238113 123/251 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472854
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.