DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30288

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:287 Identity:128/287 - (44%)
Similarity:165/287 - (57%) Gaps:35/287 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GHLLDSSCGTTKPE-FIPMITGGADAGLFSNPWMVKVL--GEKLCGGSLITSRFVLTAAHCIVST 84
            |.||::.||||... :...|.||.|||:.||||||:|:  |:.:|||||||:||||||.|||...
  Fly    24 GRLLENDCGTTSSNGYRARIDGGRDAGMESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPM 88

  Fly    85 HMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYN 149
            :|.||||||.||.|..||...|                       |.|::|.:.|||||:|:   
  Fly    89 YMNVRLGEYDTRHPIFDCDDFV-----------------------CTPRAYNVDVDRKIVHS--- 127

  Fly   150 LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESPI----FNITGWGVTNDGTPSRRLQRATV 210
             |...|||||||:..|.:|:|||||||::...:..:|:    ||.||||..:||....|||.||:
  Fly   128 -NPGYDIGLLRMQRSVIFSNYVRPICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATL 191

  Fly   211 YNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACH 275
            .......| .:..:.:|.|.|||....||:|.|||||||||...|.|....||:|:.|.|...|.
  Fly   192 QQLPQWSC-ERPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQGLRLCS 255

  Fly   276 SFSVYTNVTHHRDWIVNAIEDFSRAFQ 302
            ...:||||||..|||::.|::.|..|:
  Fly   256 GLGIYTNVTHFTDWILDVIQNHSDDFE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 116/254 (46%)
Tryp_SPc 41..290 CDD:238113 116/254 (46%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 116/255 (45%)
Tryp_SPc 45..270 CDD:238113 115/252 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.