DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30098

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:306 Identity:88/306 - (28%)
Similarity:135/306 - (44%) Gaps:70/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALLVCSIQLGEGAPGH--LLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKVLGEK--LCGGSL 68
            :.||...:.|..|:.|:  ||||.|...   |...:.||.:|.  ..|||..::.:.  .|||||
  Fly     5 IVLLTFLVILTLGSYGYSQLLDSKCIAL---FRIRVIGGQNAR--RTPWMAYLIRDNRFACGGSL 64

  Fly    69 ITSRFVLTAAHCI-VSTHMRVRLGEYKTRFPGKDCSRCV---PKSYKLRRIRLGEYDTRFPGKDC 129
            |..|||||||||. ::.::.||||||       |.||..   .:||::                 
  Fly    65 IAYRFVLTAAHCTKINDNLFVRLGEY-------DSSRTTDGQTRSYRV----------------- 105

  Fly   130 CVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEG---HMAES-PIFNI 190
                   :::.|   |.:|....::||.:|::...|.|..|:||||:|:..   .:|.| ..|.:
  Fly   106 -------VSIYR---HKNYIDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSLANSIQNFTL 160

  Fly   191 TGWGVTNDGTPSRRLQRA-------TVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGP 248
            ||||           |.|       |:....|...|:::. .|....||.......||.||||||
  Fly   161 TGWG-----------QMAHYYKMPTTLQEMSLRRVRNEYC-GVPSLSICCWNPVQYACFGDSGGP 213

  Fly   249 LSAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294
            |.:.|.:....:..|:|:.:..:..|..:|.|.::..:..|:...:
  Fly   214 LGSLVKYGHKTIYVQFGVTNSVTGNCDGYSSYLDLMSYMPWLYQTL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 76/265 (29%)
Tryp_SPc 41..290 CDD:238113 76/265 (29%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 76/265 (29%)
Tryp_SPc 37..258 CDD:238113 77/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.