DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30091

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:300 Identity:102/300 - (34%)
Similarity:140/300 - (46%) Gaps:33/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWM--VKVLGEKLCGGSL 68
            |.:.|....:..|.|: ..|||..||... :.||.|.||.|||...||||  :|...|.:||||:
  Fly     4 AWVVLFAWMLTAGRGS-ARLLDEDCGVPM-QLIPKIVGGVDAGELKNPWMALIKTNDEFICGGSV 66

  Fly    69 ITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPK 133
            ||::||||||||:.:.                  ..|:.| |....:.||.|.....|:.....:
  Fly    67 ITNKFVLTAAHCMCTD------------------EECIVK-YTQLTVTLGVYHLLATGEHNHPHE 112

  Fly   134 SYELAVDRKILHADYNL-NLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAES----PIFNITGW 193
            .|.  |:|..:|..:.: |..|||.|||::..:.|...::|:|:|:...:...    ..|...||
  Fly   113 IYN--VERVYIHDSFAIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKPQTDLIQEFTAIGW 175

  Fly   194 GVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGT--NSDACHGDSGGPLSAQVPFA 256
            |||.:|..|..||...:|..|...|.:.|....|....| |||  ..|.|..||||||...:.|.
  Fly   176 GVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDYPMFC-AGTAVGRDTCKRDSGGPLYIHMLFD 239

  Fly   257 GSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAIED 296
            |.....|.|:||.|:..|..|.:||:|..|.|:|...:.|
  Fly   240 GIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFIERIVLD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 89/257 (35%)
Tryp_SPc 41..290 CDD:238113 89/257 (35%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 89/258 (34%)
Tryp_SPc 37..276 CDD:238113 90/260 (35%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.