DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30088

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:304 Identity:96/304 - (31%)
Similarity:144/304 - (47%) Gaps:46/304 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVC---SIQLGEGAPGHLLDSSCGTT-KPEFIPMITGGADAGLFSNPWMVKVL-- 59
            |....|..::.:|   .:.|.|....:.|..|||.: :......|..|.:|.|.|.|:|..:.  
  Fly     1 MSISLASTSIYICMCVCLVLQEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYS 65

  Fly    60 GEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD-TR 123
            .|..|||::|:||::||||||     ||..|                       ::||||:| ||
  Fly    66 SEIHCGGTIISSRYILTAAHC-----MRPYL-----------------------KVRLGEHDITR 102

  Fly   124 FPGKDC----CVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAE 184
            .|  ||    |.|.:.|..:.....:..::..|.|||.||::...::::.:::||||::  :.|.
  Fly   103 NP--DCQGGSCSPPAEEFDIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICLIL--NPAA 163

  Fly   185 SP---IFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSG 246
            :|   .|...|||.|.....:..||...:...|...|||..:..:..:|:|.....||.|.||||
  Fly   164 APNVHEFQAFGWGQTETNHSANVLQTTVLTRYDNRHCRSVLSMPITINQLCVGFQGSDTCSGDSG 228

  Fly   247 GPLSAQVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWI 290
            |||..:|.:.|.|...|.|:||:|...|.|..|||.|.::..||
  Fly   229 GPLVTKVNYDGVWRYLQLGIVSFGDDKCQSPGVYTYVPNYIRWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 85/258 (33%)
Tryp_SPc 41..290 CDD:238113 85/258 (33%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 85/259 (33%)
Tryp_SPc 45..273 CDD:238113 87/260 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.