DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and CG30087

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:303 Identity:101/303 - (33%)
Similarity:142/303 - (46%) Gaps:38/303 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPM-ITGGADAGLFSNPWMVKVLGEKL- 63
            ||...|...:.:|.|:.........|:..||.|......| :..|.:|.:.|.|:||.|....| 
  Fly     1 MKTSPAWFVIAICLIRQQRIVDAQFLNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNSLT 65

  Fly    64 -CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGK 127
             ||||::.||::||||||:               ||.             .|:||||::.| ...
  Fly    66 HCGGSILNSRYILTAAHCV---------------FPN-------------LRLRLGEHNIR-TDP 101

  Fly   128 DC----CVPKSYELAVDRKILHADYN-LNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAES-P 186
            ||    |.|:|.|..:.:.|.|..|| .|..|||.||::...:.::.:::|||:|:....|.| .
  Fly   102 DCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSINFNVHIQPICILLNPASAPSVA 166

  Fly   187 IFNITGWGVTNDGTPSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTNSDACHGDSGGPLSA 251
            .:...|||.|........||.|.:...|..:|...|...::.:||||.....|.|.|||||||..
  Fly   167 TYQTFGWGETKKNGFPHLLQTAELRAYDAAYCSRSFHAYMNGNQICAGHEERDTCAGDSGGPLVT 231

  Fly   252 QVPFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWIVNAI 294
            :|.|.|.....|.|:||||...|.|..|||.|.::.:||..|:
  Fly   232 RVDFDGVKRYLQLGIVSYGPTDCQSPGVYTYVPNYINWIRRAM 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 88/256 (34%)
Tryp_SPc 41..290 CDD:238113 88/256 (34%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 88/257 (34%)
Tryp_SPc 42..272 CDD:238113 90/258 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 102 1.000 Domainoid score I4289
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.