DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Habp2

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001316864.1 Gene:Habp2 / 226243 MGIID:1196378 Length:554 Species:Mus musculus


Alignment Length:297 Identity:88/297 - (29%)
Similarity:131/297 - (44%) Gaps:70/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PGHLLDSSCGTTK--PEFIPMITGGADAGLFSNPWMVKVLGE----------KLCGGSLITSRFV 74
            ||.   .|||.|:  ...:..|.||..:....:||.|.:...          ..|||:||...:|
Mouse   290 PGF---ESCGKTEVAEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGALIHPCWV 351

  Fly    75 LTAAHC--IVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYE- 136
            ||||||  |.:.|::|.||:                                  :|....:|:| 
Mouse   352 LTAAHCTDINTKHLKVVLGD----------------------------------QDLKKTESHEQ 382

  Fly   137 -LAVDRKILHADYNLNLD---NDIGLLRMKSFVQY----SDYVRPICLLVEGHMAESPIFNITGW 193
             ..|::.:.::.||...:   |||.||::|....:    |.||:.:||..:...:.:.. :|:||
Mouse   383 TFRVEKILKYSQYNERDEIPHNDIALLKLKPVGGHCALESRYVKTVCLPSDPFPSGTEC-HISGW 446

  Fly   194 GVTNDGTPSRRLQRATVYNTDLHFCRSK--FTKQVDESQICAAG---TNSDACHGDSGGPLSAQV 253
            |||..|..||:|..|.|.......|.|:  :...:|:|.|||..   ..||.|.|||||||:.:.
Mouse   447 GVTETGEGSRQLLDAKVKLIANPLCNSRQLYDHTIDDSMICAGNLQKPGSDTCQGDSGGPLTCEK 511

  Fly   254 PFAGSWLTFQYGLVSYGSAACHSFSVYTNVTHHRDWI 290
            .  |::  :.||:||:|........|||.||...:||
Mouse   512 D--GTY--YVYGIVSWGQECGKKPGVYTQVTKFLNWI 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 80/274 (29%)
Tryp_SPc 41..290 CDD:238113 80/274 (29%)
Habp2NP_001316864.1 EGF_CA 67..103 CDD:238011
EGF_CA 150..182 CDD:238011
KR 187..271 CDD:238056
Tryp_SPc 308..547 CDD:238113 82/276 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.