DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Mst1

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_032269.3 Gene:Mst1 / 15235 MGIID:96080 Length:716 Species:Mus musculus


Alignment Length:309 Identity:77/309 - (24%)
Similarity:114/309 - (36%) Gaps:82/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CSIQ-LGEGAPGHLLD-------SSCGTTKPEFIPMITGGADAGLFSNPWMVKV---LGEKLCGG 66
            |::| ..:..|..:||       ..||....:...:...|...|  ::||.|.:   .|:..|||
Mouse   452 CALQRCDDDQPPSILDPPDQVVFEKCGKRVDKSNKLRVVGGHPG--NSPWTVSLRNRQGQHFCGG 514

  Fly    67 SLITSRFVLTAAHCIVSTH-----MRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPG 126
            ||:..::||||..||.|.|     ..|.||...        ....|....|:|:.:        .
Mouse   515 SLVKEQWVLTARQCIWSCHEPLTGYEVWLGTIN--------QNPQPGEANLQRVPV--------A 563

  Fly   127 KDCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHMA-ESPIFNI 190
            |..|.|...:|.                   ||:::..|..:.:|..|||..|.::. ......|
Mouse   564 KAVCGPAGSQLV-------------------LLKLERPVILNHHVALICLPPEQYVVPPGTKCEI 609

  Fly   191 TGWGVTNDGTPSRRLQRATVYNTDLHF----------CRSKFTKQVDESQICAAG--TNSDACHG 243
            .||| .:.||.:         ||.||.          |.:|:...:.||:||..|  ....||.|
Mouse   610 AGWG-ESIGTSN---------NTVLHVASMNVISNQECNTKYRGHIQESEICTQGLVVPVGACEG 664

  Fly   244 DSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF--SVYTNVTHHRDWI 290
            |.||||:...  ...|:.  .||:..........  :::|.|:...|||
Mouse   665 DYGGPLACYT--HDCWVL--QGLIIPNRVCARPRWPAIFTRVSVFVDWI 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 68/271 (25%)
Tryp_SPc 41..290 CDD:238113 68/271 (25%)
Mst1NP_032269.3 PAN_1 25..96 CDD:278453
KR 108..188 CDD:214527
KR 191..269 CDD:214527
KR 291..372 CDD:214527
KR 377..459 CDD:214527 2/6 (33%)
Tryp_SPc 488..709 CDD:214473 68/271 (25%)
Tryp_SPc 489..712 CDD:238113 70/272 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833174
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.