DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Gzmk

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:325 Identity:77/325 - (23%)
Similarity:126/325 - (38%) Gaps:88/325 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWM--VKVLGEKL 63
            |:|.:..|..||.         |..:.|.|..|:      |.||.:....|.|:|  ::...:.:
Mouse     1 MRFSSWALVSLVA---------GVYMSSECFHTE------IIGGREVQPHSRPFMASIQYRSKHI 50

  Fly    64 CGGSLITSRFVLTAAHC------------IVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIR 116
            |||.||..::|||||||            ::..|...:....|..|   :..:.:|.|    |::
Mouse    51 CGGVLIHPQWVLTAAHCYSWFPRGHSPTVVLGAHSLSKNEPMKQTF---EIKKFIPFS----RLQ 108

  Fly   117 LGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGH 181
            .|                                :..:||.|:::::..:.:..|:.:.|..:.:
Mouse   109 SG--------------------------------SASHDIMLIKLRTAAELNKNVQLLHLGSKNY 141

  Fly   182 MAESPIFNITGWGVTNDG--TPSRRLQRATVYNTDLHFCRSK----FTKQVDESQICA--AGTNS 238
            :.:.....:||||.|...  |.|..|:..||.......|.|:    ....:.:..|||  |....
Mouse   142 LRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAGDARGQK 206

  Fly   239 DACHGDSGGPLSAQVPFAGSWLTFQYGLVS--YGSAACHSFSVYTNVT-HHRDWIVNAIEDFSRA 300
            |:|.|||||||..:..|        :.|||  |.........:||.:| .::.||.:.:.. |||
Mouse   207 DSCKGDSGGPLICKGIF--------HALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAP-SRA 262

  Fly   301  300
            Mouse   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 63/273 (23%)
Tryp_SPc 41..290 CDD:238113 63/273 (23%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 63/280 (23%)
Tryp_SPc 26..256 CDD:238113 65/276 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833163
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.