DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Gzma

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_034500.1 Gene:Gzma / 14938 MGIID:109266 Length:260 Species:Mus musculus


Alignment Length:265 Identity:63/265 - (23%)
Similarity:99/265 - (37%) Gaps:56/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 ITGGADAGLFSNPWM--VKVLGEKLCGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCS 103
            |.||......|.|:|  :|:....:|.|:||...:|||||||.|....:..||.:......:...
Mouse    29 IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQI 93

  Fly   104 RCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDNDIGLLRMKSFVQYS 168
            ..|.|::.            :|..|     .|....|.:::.......::.::.:|.:.   :..
Mouse    94 LTVKKAFP------------YPCYD-----EYTREGDLQLVRLKKKATVNRNVAILHLP---KKG 138

  Fly   169 DYVRP--ICLLVEGHMAESPIFNITGWG-VTNDGTPSRRLQRATVYNTDLHFCRSK----FTKQV 226
            |.|:|  .|             .:.||| ..|...||..|:...:...|...|..:    |...:
Mouse   139 DDVKPGTRC-------------RVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVI 190

  Fly   227 DESQICAAGT--NSDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF---SVYTNVT-H 285
            ..:.|||...  ..|:|:||||.||...        ....|:.|:|...|...   .|||.:: .
Mouse   191 GLNMICAGDLRGGKDSCNGDSGSPLLCD--------GILRGITSFGGEKCGDRRWPGVYTFLSDK 247

  Fly   286 HRDWI 290
            |.:||
Mouse   248 HLNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 61/263 (23%)
Tryp_SPc 41..290 CDD:238113 61/263 (23%)
GzmaNP_034500.1 Tryp_SPc 28..252 CDD:214473 61/263 (23%)
Tryp_SPc 29..255 CDD:238113 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.