DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and Klk1b9

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_034246.1 Gene:Klk1b9 / 13648 MGIID:95293 Length:261 Species:Mus musculus


Alignment Length:321 Identity:82/321 - (25%)
Similarity:112/321 - (34%) Gaps:99/321 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFIAAGLALLVCSIQLGEGAPGHLLDSSCGTTKPEFIPMITGGADAGLFSNPWMVKV--LGEKL 63
            |:|:...|||.:..|.                ..|.....|.||......|.||.|.|  ..|.:
Mouse     1 MRFLILFLALSLGGID----------------AAPPVHSRIVGGFKCEKNSQPWHVAVYRYNEYI 49

  Fly    64 CGGSLITSRFVLTAAHCIVSTHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGE---YDTRFP 125
            |||.|:.:.:|||||||.                            |:..::.||:   |:..  
Mouse    50 CGGVLLDANWVLTAAHCY----------------------------YEENKVSLGKNNLYEEE-- 84

  Fly   126 GKDCCVPKSYELAVDRKILHADYNLNL------------DNDIGLLRMKSFVQYSDYVRPICLLV 178
                  |.:....|.:..||..||.:|            .||:.|||:......:|.|:||.|  
Mouse    85 ------PSAQHRLVSKSFLHPGYNRSLHRNHIRHPEYDYSNDLMLLRLSKPADITDVVKPIAL-- 141

  Fly   179 EGHMAESPIFNIT----GWGVTNDGTP-----SRRLQRATVYNTDLHFCRSKFTKQVDESQICAA 234
               ..|.|....|    |||.|   ||     ::.||...:.......|.....::|.:..:||.
Mouse   142 ---PTEEPKLGSTCLASGWGST---TPFKFQNAKDLQCVNLKLLPNEDCGKAHIEKVTDVMLCAG 200

  Fly   235 GTN--SDACHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAAC---HSFSVYTNVTHHRDWI 290
            .|:  .|.|.|||||||...        ....|:.|:|...|   ....|||.:.....||
Mouse   201 ETDGGKDTCKGDSGGPLICD--------GVLQGITSWGFTPCGEPKKPGVYTKLIKFTSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 73/279 (26%)
Tryp_SPc 41..290 CDD:238113 73/279 (26%)
Klk1b9NP_034246.1 Tryp_SPc 24..253 CDD:214473 73/280 (26%)
Tryp_SPc 25..256 CDD:238113 75/281 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.