DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and PIK3IP1

DIOPT Version :10

Sequence 1:NP_611789.2 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_443112.2 Gene:PIK3IP1 / 113791 HGNCID:24942 Length:263 Species:Homo sapiens


Alignment Length:57 Identity:16/57 - (28%)
Similarity:21/57 - (36%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SQICAAGTNSDACHGDSGGPL--SAQVPFAG----SWLTFQYGLVS--YGSAACHSF 277
            :.:.|....|..|..|:|...  ....|..|    :||..|.||.|  ...|..||:
Human    13 NMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAPVSGAGNHSY 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_611789.2 Tryp_SPc 41..290 CDD:238113 16/57 (28%)
PIK3IP1NP_443112.2 KR 22..102 CDD:238056 15/48 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..263
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.