DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and plaua

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:XP_017214157.1 Gene:plaua / 100008445 ZFINID:ZDB-GENE-090313-278 Length:421 Species:Danio rerio


Alignment Length:295 Identity:84/295 - (28%)
Similarity:131/295 - (44%) Gaps:77/295 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SCGTTKPEFIPMITGGADAGLFSNPWMVKVL-GEK-LCGGSLITSRFVLTAAHCIVSTHMRVRLG 91
            :||..:.:....|.||..:.:.|.|||..:. |:. :|||:|||..:|||||||. .|..|.::.
Zfish   152 TCGERRLDRQTKIIGGLRSTVESQPWMAAIFKGDGFICGGTLITPCWVLTAAHCF-PTGKRTQIN 215

  Fly    92 EYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTRFPGKDCCVPKSYELAVDRKILHADYNLNLDN-- 154
            .|               |..|.:..:.|.|.         .|..:..|.|.::|.|::.:.:|  
Zfish   216 RY---------------SVVLGKNAINETDP---------VKEQKFTVSRLVIHEDFDYSTENYT 256

  Fly   155 -DIGLLRMK----SFVQYSDYVRPICL------LVEGHMAESPIFNITGWGVTNDGT-------- 200
             ||.||:::    .....:..||..||      |..|...|     |.|:|....||        
Zfish   257 HDIALLKIEDCNGQCAVKTKTVRTACLPPFQQMLPVGFYCE-----IAGYGRYQKGTFKFSRYLK 316

  Fly   201 ------PSRRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTN--SDACHGDSGGPLSAQVPFAG 257
                  .|:::.:.|.||.|          :|:|:.:||.|.:  :|||.|||||||..:|    
Zfish   317 QTEVKLISQKVCQRTYYNKD----------EVNENMLCANGRDWKTDACQGDSGGPLVCEV---- 367

  Fly   258 SWLTFQYGLVSYGS--AACHSFSVYTNVTHHRDWI 290
            :.:.|.:|::|:|.  |..:...|||.|:::..||
Zfish   368 NNIMFLFGIISWGKECAEKNQPGVYTQVSNYNQWI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 80/281 (28%)
Tryp_SPc 41..290 CDD:238113 80/281 (28%)
plauaXP_017214157.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575885
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.