DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30414 and zgc:163079

DIOPT Version :9

Sequence 1:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:317 Identity:85/317 - (26%)
Similarity:129/317 - (40%) Gaps:86/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIAAGLALLVCSIQLGEGAPGHLLDSSCG----TTKPEFIPMITGGADAGLFSNPWM----VKVL 59
            |..||..||..:..||:       ...||    .||      |.||.:|...|.||.    :|..
Zfish     7 FCVAGAILLNIAGCLGQ-------SDVCGRAPLNTK------IIGGLNATQGSWPWQASINLKAT 58

  Fly    60 GEKLCGGSLITSRFVLTAAHCIV---STHMRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYD 121
            .|..||||||...:|||.|....   ::.:.|.||                     |:.:.|.  
Zfish    59 EEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLG---------------------RQTQNGS-- 100

  Fly   122 TRFPGKDCCVPKSYELA--VDRKILHADYNLNLDNDIGLLRMKSFVQYSDYVRPICLLVEGHM-A 183
                       ..||::  |.:.|.|.:|| :||:::.||::.|.|.:|||::|:||...|.: .
Zfish   101 -----------NPYEISRTVTKIIKHPNYN-SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVFV 153

  Fly   184 ESPIFNITGWGVTNDGTPS-----------RRLQRATVYNTDLHFCRSKFTKQVDESQICAAGTN 237
            :.....:||||..|  .|:           :.::...|.|.:   |.:.:...:....:||...|
Zfish   154 DGTASWVTGWGYLN--RPATVEEIMLPDVLQEVEAPIVNNFE---CNAAYGGIITNKLLCAGYLN 213

  Fly   238 SDA---CHGDSGGPLSAQVPFAGSWLTFQYGLVSYGSAACHSF-SVYTNVTHHRDWI 290
            .|.   |.||.||||  .:.....|:  |.|:|..|......: ::|..|:.:.|||
Zfish   214 EDGKAPCAGDVGGPL--VIKQGAIWI--QSGVVVSGYCGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 72/273 (26%)
Tryp_SPc 41..290 CDD:238113 72/273 (26%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 73/280 (26%)
Tryp_SPc 36..267 CDD:238113 74/275 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.