Sequence 1: | NP_611788.1 | Gene: | yellow-d2 / 37704 | FlyBaseID: | FBgn0034856 | Length: | 412 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004674.1 | Gene: | RGN / 9104 | HGNCID: | 9989 | Length: | 299 | Species: | Homo sapiens |
Alignment Length: | 273 | Identity: | 55/273 - (20%) |
---|---|---|---|
Similarity: | 93/273 - (34%) | Gaps: | 94/273 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 PHNCDVGFVYMADSIGDGIVVYDVAAQQSWRIEN------KFTYPHPDFGTFTIAGESFQLWDGT 248
Fly 249 VSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNG-SNWRLND--VSAALDQFQLLGKRGSQC 310
Fly 311 VAAAMS------------------------ESG----------FLICGLVQPASLLAWNIRTG-Y 340
Fly 341 SHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELW--------------VLSNRLQK--------- 382
Fly 383 --AFGAGLDYKEI 393 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
yellow-d2 | NP_611788.1 | MRJP | 122..411 | CDD:281074 | 55/273 (20%) |
RGN | NP_004674.1 | SGL | 16..264 | CDD:400653 | 52/268 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG3386 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |