DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and YBR053C

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_009609.1 Gene:YBR053C / 852342 SGDID:S000000257 Length:358 Species:Saccharomyces cerevisiae


Alignment Length:166 Identity:29/166 - (17%)
Similarity:54/166 - (32%) Gaps:61/166 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 YVTNEMR------PNGTLL-------------QAYPSYE------WHKSHGADCNGL-TSVYRTQ 128
            |||:.:.      |.|.||             |::.|.|      |....|.....| .:|:.|.
Yeast   213 YVTDSLNFTIWKCPGGDLLKRDELIDVKNSNNQSFESPEPDGSAIWFSKDGKHSGFLFITVWSTS 277

  Fly   129 IDECGRMWILDSGEIDFIQHCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNC 193
                                   ::...||.:||:..::.:|::..:.....||...:.:...|.
Yeast   278 -----------------------KVQMFDLTNGKLLKEFILPEQTPRVSCCCFVGKDLFVTTANA 319

  Fly   194 DV------------GFVYMADSIGDGIVVYDVAAQQ 217
            ::            |.:|...::.||.|..:...:|
Yeast   320 EINDAVRTNTDKNGGCIYKIPNVLDGNVPLESTKRQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 16/108 (15%)
YBR053CNP_009609.1 YvrE 1..345 CDD:225921 25/154 (16%)
WD40 repeat 150..186 CDD:293791
WD40 repeat 199..248 CDD:293791 8/34 (24%)
WD40 repeat 259..294 CDD:293791 8/57 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.