DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and yellow-e2

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_650289.2 Gene:yellow-e2 / 41652 FlyBaseID:FBgn0038151 Length:435 Species:Drosophila melanogaster


Alignment Length:392 Identity:209/392 - (53%)
Similarity:276/392 - (70%) Gaps:6/392 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLA 89
            ||...||:..|||.|||.:.||:|.|:|.|.||||:||||......|..|||.|||.:|||:||.
  Fly    44 VFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGPPRHFVTSPRFGQGVPFSLG 108

  Fly    90 YVTNEMRPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCPPQLY 154
            ||||..|.||:.:||||||:||.||||:|:|||||||..||.||:||:||||||:|:|||.||:.
  Fly   109 YVTNVQRENGSEIQAYPSYQWHSSHGANCDGLTSVYRVHIDACGQMWVLDSGEIEFVQHCAPQVM 173

  Fly   155 AIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVEL-DP---HNCDVGFVYMADSIGDGIVVYDVAA 215
            ..||.:.::.|:|::|:..||..|||||....:: ||   ..|...|.|:||.....||||||..
  Fly   174 VFDLATDQLIHRYRLPETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVG 238

  Fly   216 QQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLD 280
            |.|||||||||||...|||.|:|||||:|.||.::...||.|||.||.:.||:||:|.::|||||
  Fly   239 QSSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIFHALSNELELAIPLD 303

  Fly   281 VVNNGSNWRLNDVSAALDQFQLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNL 345
            ::||.:||: ..:|::|.:|.:|||||.||.:.|:|..|||.||.::|..:..|:||..|:.:|:
  Fly   304 ILNNATNWQ-KGLSSSLSEFTVLGKRGIQCASHAISRQGFLFCGFLEPIGIFGWDIRRPYNRENV 367

  Fly   346 VMLVEDEQRLQFASGLKIVRN-HEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSGR 409
            .:|..:...|||.||:||||. .:|:||||:||:||||.|...:||:|||:|:.:|.|.:||.||
  Fly   368 KLLAINPATLQFVSGMKIVRRPADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGR 432

  Fly   410 PC 411
            .|
  Fly   433 GC 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 150/293 (51%)
yellow-e2NP_650289.2 MRJP 141..434 CDD:281074 150/293 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 1 1.000 - - H119619
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27451
OrthoDB 1 1.010 - - D202564at33208
OrthoFinder 1 1.000 - - FOG0012723
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.