DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and yellow-k

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_648772.1 Gene:yellow-k / 39678 FlyBaseID:FBgn0036504 Length:342 Species:Drosophila melanogaster


Alignment Length:349 Identity:76/349 - (21%)
Similarity:129/349 - (36%) Gaps:109/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YSLAYVTNEMRPNG--TLLQA-------------YPSYEWHK--SHGADCNGLTSVYRTQIDECG 133
            :|..:::..:..|.  ||::|             :|..:.|.  .|. ||:.:...:.:|:|...
  Fly    44 FSRVFLSVNVESNDAPTLIEAQWPVSYFPMPTVVFPHIDVHSMGDHD-DCSLVQQAHWSQVDALS 107

  Fly   134 RMWILDSGEIDFIQHCPPQLYAIDLESGKV-------AHQYKMPKRLYKEGVSRFVTPTVELDP- 190
            |:|::|.|...  ..|.|:|:..||.....       .|..         |.:.....||::.| 
  Fly   108 RLWVMDIGFPG--STCSPRLFVFDLMRNNAELLRIDCGHHI---------GANDTHFLTVQMGPK 161

  Fly   191 -----HNCDVGFVYMADSIG--DGIVVYDVAAQQSW--------RIEN---KFTYPHPDFGTFTI 237
                 |...:.|:     :|  ..|:.||: .:|:|        :.||   .|.....|| .|.|
  Fly   162 SPGCEHERHIYFI-----LGKVPEILAYDI-LEQTWHRLSLESNKYENMNQSFPIKPVDF-IFGI 219

  Fly   238 AGE---SFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQ 299
            .||   |.|  ||.:.:|:             ..|..|.:..:....:||  :.:|..:.:    
  Fly   220 QGELILSDQ--DGDLYSTV-------------DRLEIEGKSELASKPINN--SIKLTHLGS---- 263

  Fly   300 FQLLGKRGSQCVAAAMSESGFLI-----CGLVQPASLLAWNIRTGYSHQNLVMLVEDEQRLQFAS 359
              |||...|..:    ...|.|.     .|.|...:.|| || |...::.:.:..::.|::.|.|
  Fly   264 --LLGSSRSMII----DNFGTLYYVIPKFGAVVRCAKLA-NI-TAEGNEIIYITSKNIQQIFFTS 320

  Fly   360 GLKIVRNHEGKEELWVLSNRLQKA 383
                      .:.|||||:|:..|
  Fly   321 ----------NDALWVLSDRVLNA 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 66/296 (22%)
yellow-kNP_648772.1 MRJP 102..>201 CDD:281074 24/115 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.