DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and yellow-g

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_523888.1 Gene:yellow-g / 38294 FlyBaseID:FBgn0041709 Length:393 Species:Drosophila melanogaster


Alignment Length:316 Identity:76/316 - (24%)
Similarity:125/316 - (39%) Gaps:59/316 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ESVFGAYNLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYS 87
            |..|......|.:|....:...::.|.|.|.:||.....:      ...|.||.:||:.:|||::
  Fly    46 ELTFQLSGSSLHWPCESTKNIYVQSGRYVPRNVIVTRAQL------QRDSAFVALPRYKQGVPFT 104

  Fly    88 LAYVTNEMRPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDF----IQH 148
            |..|..:.....|.:..||.  |......:|..|.||....:|:.|.:|.||.|.::.    |:.
  Fly   105 LGKVNLKKGECLTKIAPYPC--WAIQEEGNCQALQSVVDIAVDQNGLLWALDVGIVNTLEQPIRR 167

  Fly   149 CPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYMADSIGDGIVVYDV 213
            |.|::.||:..:.||.....:...:..|...:|:.    :|....:..|||:||:....|:|||:
  Fly   168 CSPKIVAINTANHKVVKSIDLSDLVTSESRLQFIV----VDYSKDNKPFVYVADAGARSILVYDI 228

  Fly   214 AAQQSWRIE-NKFTYPHPDF----------GT-------------FTIAGESFQLWDGT---VST 251
            ...:|:||. .|.|.|..|.          ||             ::|.||..::..|.   :..
  Fly   229 TGNKSYRIVLPKATAPTSDVLYVALTSKPDGTSTLFFSYLSSPRLYSIKGEYLRVGQGAGSIIDV 293

  Fly   252 TLTPHGL--------GGRRMMYFHSLSSE---WQ-----MAIPLDVVNNGSNWRLN 291
            ...|:|.        ||..:.:.:...::   |.     .|..|..|..|.:.||:
  Fly   294 GPKPYGKQAVLLGADGGTSLFFRYKGENDIYLWDSETCFKAANLQEVQRGGDCRLS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 51/217 (24%)
yellow-gNP_523888.1 MRJP 137..391 CDD:281074 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449248
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.