DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d2 and yellow-b

DIOPT Version :9

Sequence 1:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001285987.1 Gene:yellow-b / 35005 FlyBaseID:FBgn0032601 Length:453 Species:Drosophila melanogaster


Alignment Length:409 Identity:121/409 - (29%)
Similarity:199/409 - (48%) Gaps:29/409 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WLAASAQALESVFGAY---NLELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFV 75
            | |.||.|.:::..||   .::.::.:|.:|..|:..|.:.|.:|||..::|      |...:||
  Fly    12 W-AVSALANDNLRVAYEWREMDFKYANPDQRWSAIERGEFKPANVIPFGLEV------AGHRLFV 69

  Fly    76 TIPRFAKGVPYSLAYV-TNEMRPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILD 139
            |:||:..|||.||||: .|:....|..|:.:||::.|....|:.. |.|.:|.:.|.|||:|:||
  Fly    70 TLPRWRDGVPASLAYLDLNDTSSKGPALKPFPSWQAHNLQEAEPE-LVSPFRVRADRCGRLWVLD 133

  Fly   140 ---SGEIDFIQ-HCPPQLYAIDLESGKVAHQYKMPKRLYKEGVSRFVTPTVELDPHNCDVGFVYM 200
               ||.::..: :...||...||.:..:..::.:|....|:|   .:...:.::..:|:..|.|.
  Fly   134 SRISGVLEQTKIYGAAQLLVYDLHNDDLLRRHVLPAGQLKQG---SLLANLAVEDSDCENTFAYA 195

  Fly   201 ADSIGDGIVVYDVAAQQSWRIENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMY 265
            ||....|:|||....::|||:::.|.:|.|..|.|:|.|..||..||.....|:.....|...:|
  Fly   196 ADLGSPGLVVYSWKDEESWRVQHHFFHPDPMAGNFSINGIEFQWDDGLYGLALSKPLETGYATLY 260

  Fly   266 FHSLSSEWQMAIPLDVVNNGSNWRLNDVSAALDQFQLLGKRGSQCVAAAM---SESGFLICGLVQ 327
            ||.|.|..:.::...::.|.:   |........:|::||.||....|.|.   .::|.|...|..
  Fly   261 FHPLCSTTEFSVDTSILRNKT---LATSPMIYREFKVLGSRGPNTQAGAEFLDPDTGVLFYALPN 322

  Fly   328 PASLLAWNIRTGYSHQNLVMLVEDEQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKE 392
            ...:..|...|.:||.:...:..:...|.|.|.:|:    :.::.||||||:|.......|....
  Fly   323 LNEVACWRTATDFSHSSQSRIHMNNDTLVFPSDIKV----DDQKRLWVLSNQLPVFIYDELYAGS 383

  Fly   393 INFRIQKCGVQELLSGRPC 411
            |||||....|:|.:....|
  Fly   384 INFRILTASVKEAIENTAC 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 83/295 (28%)
yellow-bNP_001285987.1 MRJP 116..402 CDD:281074 83/295 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449211
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.