DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d and yellow-e

DIOPT Version :9

Sequence 1:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_524344.1 Gene:yellow-e / 41653 FlyBaseID:FBgn0041711 Length:530 Species:Drosophila melanogaster


Alignment Length:444 Identity:117/444 - (26%)
Similarity:204/444 - (45%) Gaps:87/444 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VETLTQWGQLEFGF--------PTAQDRENAQAAGNLVPENGTPIDVQPQYMANGQIRLFTTIPR 90
            ::...||..|.:.|        |...:.:|....|..|.::                |:|...|:
  Fly    25 LQVAKQWKLLRYNFEPQAPVSDPNFYNPQNVLITGLAVTDD----------------RIFVATPK 73

  Fly    91 FVTGIPYTLATVSATQGRNGPLLQPYPNYSWHNANGED--CDR--ITSAFRVAITECNQMWVIDS 151
            ..:|:|.|::.||..|..:.|.|..:|::::.|....|  |..  :||.:|:.:..||::|::|:
  Fly    74 LFSGVPSTVSWVSKAQFGDSPTLNAFPDWTFSNTGRSDFNCSDLILTSVYRLRVDSCNRIWLLDA 138

  Fly   152 GVIGTTQ----LCPPQLLQFALATDRLLHRFRFPNDTYIPSGSLFITPNVLVQDPPPRGTCSRTM 212
            |:..:.:    .|||::|...|||||::.|..||.:. :...|||  .|:::.:...:| |....
  Fly   139 GISRSLEDYEITCPPKILVVDLATDRVVRRIDFPPEV-LRGESLF--TNMVIDETTAKG-CDDVF 199

  Fly   213 IYVADVSYHGLVVYDHQAQTSWRAENRFMYPDPDYGKHTIAGESFYLMDGMFALNNDKRN--LYF 275
            :|:.|....|::|||.....:||..:..||||||:.:..|....|.||||:..|..|:|.  :||
  Fly   200 VYITDTVEPGIIVYDSGKDVTWRVSHPAMYPDPDFAQSEIHEHRFVLMDGVVGLTFDERTGVVYF 264

  Fly   276 HPLASASEYSVPLSALNRQQNWANGPEALPE----EFRLLGRRRSE---CAASAIDGRNNVYCVT 333
            .|||:...:||..:.|..      ||  ||:    :.:|:|::.|:   .|.|..|.     .:.
  Fly   265 QPLATDRVFSVHKNVLRA------GP--LPDGKMLDVKLVGKKSSQGIGLAVSPFDS-----SLI 316

  Fly   334 FNPVK---LFVWNVNSPYNSRNFGNLPAKSDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGT 395
            |:|:.   :..||..:...|    .|....|.||||:.:...::..|  .::.:::::.:.....
  Fly   317 FSPLSETAIASWNPTTNQQS----VLAFDRDQLQFVADITTTKSEPG--VIYAIASKFHRFFLKN 375

  Fly   396 LNSKEVNFRILRRKL---DDVQG-----------------GVFFSNDEDLTNRL 429
            ||..|.|.||:|.:|   :.:.|                 |||.::.:..||.|
  Fly   376 LNPNEFNNRIVRLELPAGNSLLGHRVALPAPPTHNSLLNYGVFNTHGQASTNAL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 87/298 (29%)
yellow-eNP_524344.1 MRJP 120..393 CDD:281074 87/295 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449235
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D940689at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.