DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d and yellow-g2

DIOPT Version :9

Sequence 1:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_647710.1 Gene:yellow-g2 / 38295 FlyBaseID:FBgn0035328 Length:382 Species:Drosophila melanogaster


Alignment Length:399 Identity:91/399 - (22%)
Similarity:165/399 - (41%) Gaps:67/399 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLIAFSLT-LAQSYGV--GVNGPRPVRTVETLTQWGQLEFGFPTAQDRENAQAAGNLVPENGTPI 70
            |::.|.|. .|:|.|.  |:..|....:.....||...:|.||.|..:...:::|..:|:|  .|
  Fly     7 LILGFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQFEFPCASTKSLFKSSGKFIPKN--VI 69

  Fly    71 DVQPQYMANGQIRLFTTIPRFVTGIPYTLATVSATQGRNGPLLQPYPNYSWHNANGEDCDRITSA 135
            ..:.|.:.:   .::..:||:..|:|.||...|...|......:|||  .|......:|..:.|.
  Fly    70 ATRAQLIGD---TIYLALPRYRKGVPATLVKTSIKPGTCSTTFKPYP--CWDLQEEGNCKALQSV 129

  Fly   136 FRVAITECNQMWVIDSGVIGTTQL----CPPQLLQFALATDRLLHRFRFPNDTYIPSGSLFITPN 196
            ..:.:.:...:||:|:|::.|.:.    |||:::..::.|.::|........|...|...:    
  Fly   130 VDLVVDQNEVLWVLDTGIVNTLETPVRKCPPKVVAMSVKTGKVLKTVSLEGLTSSNSRLQY---- 190

  Fly   197 VLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQTSWRAENRFMYPDPDYGKHTIAG----ESF 257
             ||.|..|.|.|   .:||:|.:...::||:.||...:|.    :.|     |...||    :..
  Fly   191 -LVVDYAPDGGC---FVYVSDAANRAIIVYNLQADRGFRV----VLP-----KAVTAGCRSRDVL 242

  Fly   258 YLMDGMFALNNDKRNLYFHPLASASEYSVPLSALNRQQNWANGPEALPEEFRL--LGRRRSECAA 320
            |:  .:...:.....|||..|::...:|:....|  :...|:|        |:  ||::.|....
  Fly   243 YI--ALIRRDCGSTELYFTYLSTNKLFSLKSEYL--RSGVADG--------RILDLGKKPSRMVI 295

  Fly   321 SAIDGRNNVYCVTFNPVKLFVWNVNSPYNSRNFGNLPAKSDDLQFV---------SGMKVL---- 372
            ...|..:.::.......:::.|:.||.:...||..: .:|...|.|         :.|:||    
  Fly   296 IGTDNGSAIFFRNEGDAEVYRWDTNSTFVEANFKPV-YRSQTCQLVTHAVPDYKRNTMRVLQSNF 359

  Fly   373 ----RNREG 377
                :||.|
  Fly   360 PDYMQNRVG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 59/272 (22%)
yellow-g2NP_647710.1 MRJP 127..381 CDD:281074 59/272 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.