DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment yellow-d and yellow-d2

DIOPT Version :9

Sequence 1:NP_523820.2 Gene:yellow-d / 37703 FlyBaseID:FBgn0041712 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_611788.1 Gene:yellow-d2 / 37704 FlyBaseID:FBgn0034856 Length:412 Species:Drosophila melanogaster


Alignment Length:382 Identity:158/382 - (41%)
Similarity:220/382 - (57%) Gaps:12/382 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LEFGFPTAQDRENAQAAGNLVPENGTPIDVQPQYM-ANGQIRLFTTIPRFVTGIPYTLATVSATQ 106
            ||..||:.|:|:.|...|...|.:..||||...|. .:....:|.|||||..|:||:||.|:...
  Fly    31 LELEFPSPQERQRALRDGLYDPGSVIPIDVDVYYKHGDATPSIFVTIPRFAKGVPYSLAYVTNEM 95

  Fly   107 GRNGPLLQPYPNYSWHNANGEDCDRITSAFRVAITECNQMWVIDSGVIGTTQLCPPQLLQFALAT 171
            ..||.|||.||:|.||.::|.||:.:||.:|..|.||.:||::|||.|...|.|||||....|.:
  Fly    96 RPNGTLLQAYPSYEWHKSHGADCNGLTSVYRTQIDECGRMWILDSGEIDFIQHCPPQLYAIDLES 160

  Fly   172 DRLLHRFRFPNDTYIPSGSLFITPNVLVQDPPPRGTCSRTMIYVADVSYHGLVVYDHQAQTSWRA 236
            .::.|:::.|...|....|.|:||.|.: ||   ..|....:|:||....|:||||..||.|||.
  Fly   161 GKVAHQYKMPKRLYKEGVSRFVTPTVEL-DP---HNCDVGFVYMADSIGDGIVVYDVAAQQSWRI 221

  Fly   237 ENRFMYPDPDYGKHTIAGESFYLMDGMFALN------NDKRNLYFHPLASASEYSVPLSALNRQQ 295
            ||:|.||.||:|..|||||||.|.||..:..      ..:|.:|||.|:|..:.::||..:|...
  Fly   222 ENKFTYPHPDFGTFTIAGESFQLWDGTVSTTLTPHGLGGRRMMYFHSLSSEWQMAIPLDVVNNGS 286

  Fly   296 NW-ANGPEALPEEFRLLGRRRSECAASAIDGRNNVYCVTFNPVKLFVWNVNSPYNSRNFGNLPAK 359
            || .|...|..::|:|||:|.|:|.|:|:.....:.|....|..|..||:.:.|:.:|...|...
  Fly   287 NWRLNDVSAALDQFQLLGKRGSQCVAAAMSESGFLICGLVQPASLLAWNIRTGYSHQNLVMLVED 351

  Fly   360 SDDLQFVSGMKVLRNREGQEELWMLSNRYQKIAAGTLNSKEVNFRILRRKLDDVQGG 416
            ...|||.||:|::||.||:||||:||||.||.....|:.||:||||.:..:.::..|
  Fly   352 EQRLQFASGLKIVRNHEGKEELWVLSNRLQKAFGAGLDYKEINFRIQKCGVQELLSG 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
yellow-dNP_523820.2 MRJP 133..413 CDD:281074 118/286 (41%)
yellow-d2NP_611788.1 MRJP 122..411 CDD:281074 119/291 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449190
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3386
Homologene 1 1.000 - - H119619
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27451
OrthoDB 1 1.010 - - D202564at33208
OrthoFinder 1 1.000 - - FOG0012723
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10009
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.