DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARF3 and Arl2

DIOPT Version :10

Sequence 1:NP_001650.1 Gene:ARF3 / 377 HGNCID:654 Length:181 Species:Homo sapiens
Sequence 2:NP_476886.1 Gene:Arl2 / 40993 FlyBaseID:FBgn0004908 Length:184 Species:Drosophila melanogaster


Alignment Length:175 Identity:80/175 - (45%)
Similarity:114/175 - (65%) Gaps:5/175 - (2%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGNIFGNLLKSLIGK-KEMRILMVGLDAAGKTTILYKLKLGEIVTTI-PTIGFNVETVEYKNISF 63
            ||  |..:||.:..| :|||||::|||.|||||||.:.. ||.:.|| ||:|||::|:|:...:.
  Fly     1 MG--FLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFN-GEPIDTISPTLGFNIKTLEHNGYTL 62

Human    64 TVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQ 128
            .:||||||..:|..||:||::|.||::||||.||.|:....:||..:|.|:.|..|.|||..|||
  Fly    63 NMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQ 127

Human   129 DLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWL 173
            |||.|:::.||.:.|.|..:...:|.:....|.:|:.|...:|||
  Fly   128 DLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARF3NP_001650.1 P-loop containing Nucleoside Triphosphate Hydrolases 5..179 CDD:476819 78/171 (46%)
Arl2NP_476886.1 Arl2 3..175 CDD:206720 78/171 (46%)

Return to query results.
Submit another query.