DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARF3 and Arl8

DIOPT Version :10

Sequence 1:NP_001650.1 Gene:ARF3 / 377 HGNCID:654 Length:181 Species:Homo sapiens
Sequence 2:NP_649769.1 Gene:Arl8 / 40961 FlyBaseID:FBgn0037551 Length:186 Species:Drosophila melanogaster


Alignment Length:172 Identity:53/172 - (30%)
Similarity:96/172 - (55%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    10 KSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIV-TTIPTIGFNVETVEYKNISFTVWDVGGQDK 73
            ||:..|:||.:.:|||..:||||.:..:..|:.. ..|||:|||:..:...|::..|||:|||.:
  Fly    13 KSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPR 77

Human    74 IRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAE 138
            .|.:|..|.:....::::||:.|.:::..:|.||..:|.:.:|....:||..||:|||.|::...
  Fly    78 FRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETG 142

Human   139 ITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNK 180
            :.:::.|.|::.|.....:......|.:...|.||....|::
  Fly   143 LIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARF3NP_001650.1 P-loop containing Nucleoside Triphosphate Hydrolases 5..179 CDD:476819 52/169 (31%)
Arl8NP_649769.1 Arl10_like 22..180 CDD:206724 47/157 (30%)

Return to query results.
Submit another query.