DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARF3 and Arl6

DIOPT Version :10

Sequence 1:NP_001650.1 Gene:ARF3 / 377 HGNCID:654 Length:181 Species:Homo sapiens
Sequence 2:NP_611421.1 Gene:Arl6 / 37236 FlyBaseID:FBgn0034446 Length:202 Species:Drosophila melanogaster


Alignment Length:186 Identity:64/186 - (34%)
Similarity:110/186 - (59%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


Human     1 MGNI--FGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTI--PTIGFNVET--VEYK 59
            ||.:  ..:|:|  |.|.:|.||::||:.:||::|:...|.....|:|  ||:||.||.  :...
  Fly     1 MGMLHNLADLIK--IKKDKMTILVLGLNNSGKSSIINHFKKSSEQTSIVVPTVGFMVEQFYIGMS 63

Human    60 NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDEL--RDAVLL 122
            .:|....|:.|..:.|.||.|.|:|..|:|:|:||:||.|....::||..:|...:|  |...:|
  Fly    64 GVSIKAIDMSGATRYRNLWEHQFKNCHGIIYVIDSSDRMRFVVVKDELDLVLQHPDLCNRIVPIL 128

Human   123 VFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLK 178
            .:.||.|:.:::::.:|...|.|.:::.:.|:|.::.|.||:||.||:.||..|::
  Fly   129 FYGNKMDMEDSLSSVKIAAALRLENIKDKPWHICSSSAISGEGLGEGVQWLIQQMR 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARF3NP_001650.1 P-loop containing Nucleoside Triphosphate Hydrolases 5..179 CDD:476819 62/180 (34%)
Arl6NP_611421.1 Arl6 19..182 CDD:206722 56/162 (35%)

Return to query results.
Submit another query.