DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mthfs and 5-FCL

DIOPT Version :10

Sequence 1:NP_001097432.1 Gene:Mthfs / 37699 FlyBaseID:FBgn0085453 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_568284.1 Gene:5-FCL / 831144 AraportID:AT5G13050 Length:277 Species:Arabidopsis thaliana


Alignment Length:210 Identity:69/210 - (32%)
Similarity:117/210 - (55%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVALRKRMKDALKGIDAEAIARQSQAVTAKVLQSEIFRQAQRVSIYLSTAS--ELDTTALLSEMF 72
            |..:|..::.:||.:|.....:|.:|:...||::..|:..:.:..|:|..|  |:||:.:|||:.
plant    60 KRVVRSTVRKSLKAMDPSLRTQQDEAIQKTVLEAPWFKSCKGLCAYISCKSLNEVDTSKILSEIL 124

  Fly    73 R-----LEKMVFVPTYE--GSRMKMVRLRGMEEYESLPLTKWNIKQPDFKEA----REDAMTNGH 126
            :     .:|.::||..|  .|.|:|:.:..||:   |.....||.:|...:|    |||.:....
plant   125 QHPDSNTQKKLYVPWVEDKNSNMRMLHISHMED---LVANSMNILEPAPVDAQGNDREDVLQADE 186

  Fly   127 GIDLFIVPGVAFTRCGARMGHGMGYYDKFLKQHAE-------KYPHKKISLMALSLNEQIVSNEE 184
            .|||||:||:||.|||.|:|.|.||||.|||::.:       :||    .::|||.:.||:.:..
plant   187 PIDLFILPGLAFDRCGRRLGRGGGYYDTFLKRYQDRAKEKGWRYP----LMVALSYSPQILEDGS 247

  Fly   185 LPMESHDVRLHSVIT 199
            :|:..:||.:.:::|
plant   248 IPVTPNDVLIDALVT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MthfsNP_001097432.1 FAU1 10..201 CDD:439982 69/210 (33%)
5-FCLNP_568284.1 PLN02812 54..267 CDD:178408 69/210 (33%)

Return to query results.
Submit another query.