DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mthfs and lost

DIOPT Version :10

Sequence 1:NP_001097432.1 Gene:Mthfs / 37699 FlyBaseID:FBgn0085453 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_649466.1 Gene:lost / 40559 FlyBaseID:FBgn0263594 Length:545 Species:Drosophila melanogaster


Alignment Length:160 Identity:38/160 - (23%)
Similarity:72/160 - (45%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QNTLKVALRKRMKDALKGIDAEAIARQ------SQAVTAKVLQSEIFRQAQRVSIYLS-TASELD 63
            :.:|:|...|::::...||....|..:      :....|.....|.|::||.:.:.:. ...|..
  Fly    34 KRSLRVQTWKKIQEGKVGIGFNNIFNRIPSFVGADKAAALFANEEEFKKAQHIKVNIDRVLHEFK 98

  Fly    64 TTALLSEMFRLEKMVFVP-TYEGSRMKM---VRLRGMEEYESLPLTKWNIKQPDFKEAR-EDAMT 123
            ..|||:     :|.|::| |.|.|.:.:   |.....||.:     |..::..|.::.| |..:.
  Fly    99 ELALLA-----DKSVYLPSTRESSALCLKVDVLADATEEQK-----KEALRVQDIQKFRSEIGLD 153

  Fly   124 NGHGIDLFIVPGVAFTRCGARMGHGMGYYD 153
            :|..:|:.::..|..:|.|.|:|.|.|:.|
  Fly   154 SGLKLDIVVIGSVVVSREGYRIGRGNGFAD 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MthfsNP_001097432.1 FAU1 10..201 CDD:439982 37/156 (24%)
lostNP_649466.1 5-FTHF_cyc-lig 34..232 CDD:444864 38/160 (24%)
RRM_SF 384..455 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.