DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3500 and SVP26

DIOPT Version :9

Sequence 1:NP_001261152.1 Gene:CG3500 / 37697 FlyBaseID:FBgn0034849 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_012051.3 Gene:SVP26 / 856587 SGDID:S000001224 Length:228 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:68/194 - (35%)
Similarity:107/194 - (55%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLYLLGWVSLAIQIVFLTLSIVAGLYYLAELAEEYTTAARKCILFLISFTIFVYILLLLFEDLPW 67
            :|.|:.:.......:||||||.:||||::||.||:|...|:.:...|...|.:.|||||.:..|:
Yeast     2 LLELISYAGTVSGFLFLTLSIASGLYYISELVEEHTEPTRRFLTRAIYGIILILILLLLLDGFPF 66

  Fly    68 SLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGSLAMLVVNHFLAFQHFVTVYVP----------- 121
            .|.:..:.....:...:..|||:.|.|...|.|...:|:||:..|::|....||           
Yeast    67 KLTLFSIACYIVYYQNLKSFPFISLTSPTFLLSCVCVVLNHYFWFKYFNDTEVPPQFKFDPNYIP 131

  Fly   122 -----FTQVLAYFTICMWIVPFALFVSLSANDSVLPTTVSDQ--SRRSPDVVSNYFSRNKKQGL 178
                 |.:|.::|.||:|.:||||||||||.|.||||| |:|  ::::.|:.:|...:.:|:.:
Yeast   132 RRRASFAEVASFFGICVWFIPFALFVSLSAGDYVLPTT-SEQHMAKKNDDITTNNQPKFRKRAV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3500NP_001261152.1 Erv26 1..187 CDD:282060 68/194 (35%)
SVP26NP_012051.3 Erv26 2..205 CDD:398015 68/194 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343927
Domainoid 1 1.000 116 1.000 Domainoid score I1313
eggNOG 1 0.900 - - E1_KOG4136
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6131
Inparanoid 1 1.050 116 1.000 Inparanoid score I1334
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53537
OrthoFinder 1 1.000 - - FOG0006399
OrthoInspector 1 1.000 - - oto99894
orthoMCL 1 0.900 - - OOG6_104172
Panther 1 1.100 - - LDO PTHR13144
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1418
SonicParanoid 1 1.000 - - X4665
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.