DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3500 and SPCC1795.10c

DIOPT Version :9

Sequence 1:NP_001261152.1 Gene:CG3500 / 37697 FlyBaseID:FBgn0034849 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_588034.1 Gene:SPCC1795.10c / 2538756 PomBaseID:SPCC1795.10c Length:227 Species:Schizosaccharomyces pombe


Alignment Length:206 Identity:55/206 - (26%)
Similarity:97/206 - (47%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVLYLLGWVSLAIQIVFLTLSIVAGLYYLAELAEEYTTAARKCILFLISFTIFVYILLLLFEDL 65
            |.||..|.::.:.:..:.:|:||.:.|||::|..||::..|:..:..|:.|.:.|.:.|::|:..
pombe     1 MIVLNALSYLGIVLGFIGMTVSIASALYYISEFVEEHSRLAKAFLCRLVYFIMAVMVFLVIFDGF 65

  Fly    66 PWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGSLAMLVVNHFL-------------------- 110
            |:.|....:.:...:......|||.....:..|.:..::|.||.|                    
pombe    66 PFWLSAFSIFSHYIYKINFDTFPFFSFKRMRFLLACFLIVANHILWVRFFQVHEFPIKPRGLTYD 130

  Fly   111 -AFQHFVTVYVPFTQVLAYFTICMWIVPFALFVSLSANDSVLPTTVSDQSRRSPDVVSNYFSRNK 174
             ..|..:|....|:||.::..:|:|.||..:|||.:|.|:.|| |::..|..|||..|:..||..
pombe   131 FVGQRLLTSRASFSQVASFMGVCVWSVPIGIFVSFTAADNTLP-TITTPSSSSPDAYSSGSSRRT 194

  Fly   175 KQGLLSLFQYL 185
            ...|...::.|
pombe   195 SNVLRQAYKKL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3500NP_001261152.1 Erv26 1..187 CDD:282060 55/206 (27%)
SPCC1795.10cNP_588034.1 Erv26 1..205 CDD:282060 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2149
eggNOG 1 0.900 - - E1_KOG4136
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1776
OMA 1 1.010 - - QHG53537
OrthoFinder 1 1.000 - - FOG0006399
OrthoInspector 1 1.000 - - oto101586
orthoMCL 1 0.900 - - OOG6_104172
Panther 1 1.100 - - LDO PTHR13144
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1418
SonicParanoid 1 1.000 - - X4665
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.