DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3500 and tex261

DIOPT Version :9

Sequence 1:NP_001261152.1 Gene:CG3500 / 37697 FlyBaseID:FBgn0034849 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001107323.1 Gene:tex261 / 100135128 XenbaseID:XB-GENE-1006423 Length:196 Species:Xenopus tropicalis


Alignment Length:198 Identity:95/198 - (47%)
Similarity:136/198 - (68%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVLYLLGWVSLAIQIVFLTLSIVAGLYYLAELAEEYTTAARKCILFLISFTIFVYILLLLFEDL 65
            |..:|:|.|:||.:|:.|:||:|.|||||||||.||||.|..:.|.::|.|:..|.|.|.|||..
 Frog     1 MWFIYILSWLSLFVQVAFVTLAIAAGLYYLAELIEEYTVATSRIIKYMIWFSTGVLICLYLFEKF 65

  Fly    66 PWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGSLAMLVVNHFLAFQHFVTVYVPFTQVLAYFT 130
            |..:|..||.....:.|::..|||:.|.|...:.|..::|:||:||||:|...|.||::||||||
 Frog    66 PTIMIGVGLFTNVVYFGLLQTFPFIMLTSPNFILSCVLVVLNHYLAFQYFAEEYYPFSEVLAYFT 130

  Fly   131 ICMWIVPFALFVSLSANDSVLPTTVSDQSRRSPDVVSNYFS---RNKKQGLLSLFQYLKEALLPG 192
            .|:|::||:.||||||.::|||:|:    ::..|||||||:   |.|:.|:|.:|.::|||:||.
 Frog   131 FCLWLIPFSFFVSLSAGENVLPSTI----QQGDDVVSNYFTKGKRGKRSGILVIFSFIKEAILPS 191

  Fly   193 RTK 195
            |.|
 Frog   192 RQK 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3500NP_001261152.1 Erv26 1..187 CDD:282060 88/188 (47%)
tex261NP_001107323.1 Erv26 1..186 CDD:367842 88/188 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3957
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6131
Inparanoid 1 1.050 203 1.000 Inparanoid score I3643
OMA 1 1.010 - - QHG53537
OrthoDB 1 1.010 - - D1338610at2759
OrthoFinder 1 1.000 - - FOG0006399
OrthoInspector 1 1.000 - - oto104412
Panther 1 1.100 - - LDO PTHR13144
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1418
SonicParanoid 1 1.000 - - X4665
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.