DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9863 and MBA1

DIOPT Version :9

Sequence 1:NP_611780.3 Gene:CG9863 / 37694 FlyBaseID:FBgn0034846 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_009744.3 Gene:MBA1 / 852483 SGDID:S000000389 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:203 Identity:36/203 - (17%)
Similarity:71/203 - (34%) Gaps:64/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KLRVMQFLSGLRHRYCLWRLRRLLGVAFDEGGFHEGTRQAAVTMIDAVRQADWPCIRSCCTERGS 111
            ::.:.:|.||::..:.||:                  .:|..|.|:         :.:....:..
Yeast    98 QVALFRFQSGIKPSFLLWK------------------NKAIETYIN---------VNTSFAHKNL 135

  Fly   112 ADIYGLSQM--------RSPYC--------SLVRFQKEHLRHALP--VRVVRRWIDGR--YYVMV 156
            :||.||..:        ||...        .|::|      :|:|  |.|....|.|.  .::.:
Yeast   136 SDIKGLVSLWVQEALEARSRQLPGNATLDWQLIKF------NAVPKLVSVQPIMIPGMPLEHLQL 194

  Fly   157 DMLFVGLRNLLDLGTEQEKEEMLQRIQSVLVNSQIDDKFEPSNCRLAIAEIVLTFSMELGDPQD- 220
            ...|...:.|:.:..:.:|.|.|.|       ..:|  :....|.....:::|..|:....|.| 
Yeast   195 VYKFDTKQRLIKVNQQTKKTETLDR-------DVVD--YIAFLCDATTNDMILMGSLFESKPNDK 250

  Fly   221 -PRDIESE 227
             |:..|.:
Yeast   251 LPKSYEDD 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9863NP_611780.3 None
MBA1NP_009744.3 MBA1 51..278 CDD:254545 36/203 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13333
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.